General Information

  • ID:  hor004008
  • Uniprot ID:  B7PV73??70-78)
  • Protein name:  Pyrokinin-1
  • Gene name:  NA
  • Organism:  Ixodes scapularis (Black-legged tick) (Deer tick)
  • Family:  Pyrokinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Ixodes (genus), Ixodinae (subfamily), Ixodidae (family), Ixodoidea (superfamily), Ixodida (order), Parasitiformes (superorder), Acari (subclass), Arachnida (class), Chelicerata (subphylum), Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  RSNNFTPRI
  • Length:  9(70-78)
  • Propeptide:  MGANRQLLMRAFWLQLLFSTLTLGVGGLIPFPRVGRSAGRDLGRGPEELLTLDTELGSDWAFLLLPYKRRSNNFTPRIGAKRRSVSEDGGHGDSSDMRALSRHSWPALDWSYPRMSQQMIPVPRNGRGSFVPRLGKRRMGYDDPESWDSREFSASGDPKRGSFTPRIGRAAFTPRIGRTPFTPRIGRSGDSNKDTMSNDDKAQSASGSDSNSRSSV
  • Signal peptide:  MGANRQLLMRAFWLQLLFSTLTLG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-B7PV73-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004008_AF2.pdbhor004008_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 124709 Formula: C47H77N17O14
Absent amino acids: ACDEGHKLMQVWY Common amino acids: NR
pI: 12.5 Basic residues: 2
Polar residues: 4 Hydrophobic residues: 2
Hydrophobicity: -131.11 Boman Index: -4119
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 43.33
Instability Index: 3263.33 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  19540946
  • Title:  The Neuropeptidomics of Ixodes Scapularis Synganglion